PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_021633-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family HD-ZIP
Protein Properties Length: 837aa    MW: 90827.8 Da    PI: 6.2145
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_021633-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.73e-21139194156
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      +++ +++t++q++eLe++F+++++p++++r eL+kkl L++rqVk+WFqNrR+++k
  AHYPO_021633-RA 139 KKRYHRHTPQQIQELEAVFKECPHPDEKQRLELSKKLCLETRQVKFWFQNRRTQMK 194
                      688999***********************************************999 PP

2START1931.4e-603495741206
                      HHHHHHHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEE CS
            START   1 elaeeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kae 80 
                      ela+ a++elvk+a+++ep+W +s      e +n de++++f +  +     + +ea r++g+v+ ++  lve+++d + +W e+++    +a+
  AHYPO_021633-RA 349 ELALGAMDELVKLAQSDEPLWLRSMdsggrEVLNHDEYMRSFNPIIGmkpngFVSEATRETGMVIINSLALVETIMDAN-RWAEMFPgmiaRAT 441
                      57899************************99***********9977799999***************************.************** PP

                      EEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEE CS
            START  81 tlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwv 167
                      t++vissg      galqlm  elq+lsplvp R + f+R+++q+ +g+w++vdvS+d  ++ + s+ +v +++lpSg+++++++ng+skvtwv
  AHYPO_021633-RA 442 TTDVISSGmggtrnGALQLMHCELQVLSPLVPvRVVNFLRFCKQHAEGVWAVVDVSIDCIRESSISPTYVNCRRLPSGCVVQDMPNGYSKVTWV 535
                      **************************************************************999***************************** PP

                      E-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
            START 168 ehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                      eh +++++++h+l+r+lv+sgl +ga++w  tlqrqce+
  AHYPO_021633-RA 536 EHSEYEESSIHQLYRPLVSSGLGFGAQRWITTLQRQCEC 574
                      *************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.24E-20124196IPR009057Homeodomain-like
PROSITE profilePS5007117.232136196IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.1E-22136204IPR009057Homeodomain-like
SMARTSM003891.7E-18137200IPR001356Homeobox domain
CDDcd000863.78E-19138196No hitNo description
PfamPF000469.3E-19139194IPR001356Homeobox domain
PROSITE patternPS000270171194IPR017970Homeobox, conserved site
PROSITE profilePS5084843.593340577IPR002913START domain
SuperFamilySSF559619.89E-34342574No hitNo description
CDDcd088759.87E-122344573No hitNo description
SMARTSM002345.4E-43349574IPR002913START domain
PfamPF018523.9E-52350574IPR002913START domain
SuperFamilySSF559611.43E-24602829No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 837 aa     Download sequence    Send to blast
MNFGGFLDSS GGTGSEGGGG GGGARLVTDI PYNNHNMPPG AISPHQQQQQ RLVGPTSMNN  60
KSFFNTPGLS LALQTGMEGH GEVTRVTDQN YEANGNGGGT TIGARRSRDN EEHESRSGSD  120
NLDGASGDEQ DASDLPPRKK RYHRHTPQQI QELEAVFKEC PHPDEKQRLE LSKKLCLETR  180
QVKFWFQNRR TQMKTQLERH ENSILRQEND KLRAENMSIR EALRNPICNN CGGPAMIGDI  240
SMEEQHLRIE NGRLKEELDR VCALASKFIG RPVSSLSGLS APPMPSSSLE LAVGTNGFGP  300
LNTVTTSSLP LAPDFGSGIS NALPVVSPTK STANVSGIER SFERSMYLEL ALGAMDELVK  360
LAQSDEPLWL RSMDSGGREV LNHDEYMRSF NPIIGMKPNG FVSEATRETG MVIINSLALV  420
ETIMDANRWA EMFPGMIARA TTTDVISSGM GGTRNGALQL MHCELQVLSP LVPVRVVNFL  480
RFCKQHAEGV WAVVDVSIDC IRESSISPTY VNCRRLPSGC VVQDMPNGYS KVTWVEHSEY  540
EESSIHQLYR PLVSSGLGFG AQRWITTLQR QCECLAILMS ANIPSGDHNA ITAGGRRSML  600
KLAQRMTNNF CAGVCASTVH KWNKLNMGNI DEDVRVMTRK SMDDPGEPSG IVLSAATSVW  660
LPVTPQRLFD FLRDERLRSE WDILSNGGPM QEMAHIAKGH DQGNCVSLLR AGAVNPNQSS  720
MLILQETCTD ASGSLVVYAP VDIPAMHVVM NGGDSAYVAL LPSGFAIVPD GSGSRGPNIS  780
MDATPQRVGG SLLTVAFQIL VNSLPTAKLT VESVETVSNL ISCTVQKIKA ALNCES*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010671720.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A0K9QLI30.0A0A0K9QLI3_SPIOL; Uncharacterized protein
STRINGVIT_15s0048g02000.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein